Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4anoA_

Fold library idPDB HeaderMoleculeTitle
c4anoA_PDB header: membrane proteinChain: A: PDB Molecule: essb;PDBTitle: crystal structure geobacillus thermodenitrificans essb cytoplasmic2 fragment


Added to library: Thu Jan 10 10:13:15 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SEKKTYLETQLDAVXINDQPYTVIFQRAKLKXQDPLELEVLKEVDPCIVRDIDVSEDEVKVVIKPPSSFL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)




T
TTGGG



SGGGGGGGGGS
SSS
SS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TFAAIRKTTLLSRIRAAIHLVSKVKHHSARRLIFIVCPENLXFNRALEPFFLHVGVKESLPPDEWDDERL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TS
SS

SSS



GGG
TT

S

TTTBSS
S

 .........150.........160.........170.........180.........190.........200.........
Sequence LREVKATVLALTEGEYRFDEYLKFHETLKCSPIAKELWQADHLDAVLAVLEKWVDEEEAKERAKVHIPK
Predicted secondary structure


















SS confidence




































































Known secondary structure (DSSP) TT
SS
TTTS



SSTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D