Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4anoA_

Fold library idPDB HeaderMoleculeTitle
c4anoA_PDB header: membrane proteinChain: A: PDB Molecule: essb;PDBTitle: crystal structure geobacillus thermodenitrificans essb cytoplasmic2 fragment


Added to library: Thu Jan 10 10:13:15 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SEKKTYLETQLDAVXINDQPYTVIFQRAKLKXQDPLELEVLKEVDPCIVRDIDVSEDEVKVVIKPPSSFL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)




T
TTGGG



SGGGGGGGGGS
SSS
SS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TFAAIRKTTLLSRIRAAIHLVSKVKHHSARRLIFIVCPENLXFNRALEPFFLHVGVKESLPPDEWDDERL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TS
SS

SSS



GGG
TT

S

TTTBSS
S

 .........150.........160.........170.........180.........190.........200.........
Sequence LREVKATVLALTEGEYRFDEYLKFHETLKCSPIAKELWQADHLDAVLAVLEKWVDEEEAKERAKVHIPK
Predicted secondary structure


















SS confidence




































































Known secondary structure (DSSP) TT
SS
TTTS



SSTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D