Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4ablA_

Fold library idPDB HeaderMoleculeTitle
c4ablA_PDB header: transferaseChain: A: PDB Molecule: poly [adp-ribose] polymerase 14;PDBTitle: human parp14 (artd8, bal2) - macro domain 3


Added to library: Wed Jan 9 23:24:41 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQ
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
B


B
SSTT
TTS
GGG
B
S
TTS


ST
 .........80.........90.........100.........110.........120.........130.........140
Sequence AQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S

S
TTSBSSTTS
TT



TTSSTT


 .........150.........160.........170.........180.
Sequence IDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREG
Predicted secondary structure










SS confidence








































Known secondary structure (DSSP) TT

SS

S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D