Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3zx1A_

Fold library idPDB HeaderMoleculeTitle
c3zx1A_PDB header: oxidoreductaseChain: A: PDB Molecule: oxidoreductase, putative;PDBTitle: multicopper oxidase from campylobacter jejuni: a metallo-oxidase


Added to library: Sat Dec 17 18:17:21 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TSFINFAPKNLKLLDPKQFPQGEILKALPLLKNESKEKNIFHATLEIKENHIELIKGKKTLFYTYNGLVP
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
TT




TT

B

GGGS
BS
B




B





STT

STT

TTBSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence APKIEVFEGDKLEILVKNKLKEATTIHWHGVPVPPDQDGSPHDPILAGEERIYRFEIPQDSAGTYWYHPH
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

BTT

SSS
B

T



GGGS

TTS
B
TT


TT



 .........150.........160.........170.........180.........190.........200.........210
Sequence PHYTASKQVFMGLAGAFVIKAKKDALSHLKEKDLMISDLRLDENAQIPNNNLNDWLNGREGEFVLINGQF
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
TTTTT


SS
TTTTS

BTTS









STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence KPKIKLATNERIRIYNATAARYLNLRIQGAKFILVGTDGGLIEKTIYKEELFLSPASRVEVLIDAPKDGN
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S
TT

SS

TT
TTSS
TT

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence FKLESAYYDRDKMMVKEEPNTLFLANINLKKENVELPKNLKIFKPSEEPKEFKEIIMSEDHMQMHGMMGK
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP)






SS













S
S











STTTTGGG
 .........360.........370.........380.........390.........400.........410.........420
Sequence SEGELKIALASMFLINRKSYDLKRIDLSSKLGVVEDWIVINKSHMDHPFHIHGTQFELISSKLNGKVQKA
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
TTTTB


TT


TT


SSS
TT

TT
 .........430.........440.........450.........460.........470.
Sequence EFRALRDTINVRPNEELRLRMKQDFKGLRMYHCHILEHEDLGMMGNLEVKE
Predicted secondary structure



















SS confidence


















































Known secondary structure (DSSP) SS

S
TT



S
SSTT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D