Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3zrhA_

Fold library idPDB HeaderMoleculeTitle
c3zrhA_PDB header: hydrolaseChain: A: PDB Molecule: ubiquitin thioesterase zranb1;PDBTitle: crystal structure of the lys29, lys33-linkage-specific trabid otu2 deubiquitinase domain reveals an ankyrin-repeat ubiquitin binding3 domain (ankubd)


Added to library: Sat Dec 17 19:16:12 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAAIEAYKSSGGDIARQLTADEVRLLNRPSAFDVGYT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



T

T
TTT

TT





TTT

TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence LVHLAIRFQRQDMLAILLTEVSQQAAKCIPAMVCPELTEQIRREIAASLHQRKGDFACYFLTDLVTFTLP
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT




T

SS


S





B
 .........150.........160.........170.........180.........190.........200.........210
Sequence ADIEDLPPTVQEKLFDEVLDRDVQKELEEESPIINWSLELATRLDSRLYALWNRTAGDCLLDSVLQATWG
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) GGGGGS
B
TTSSSSS

TTT


B



SS
TTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence IYDKDSVLRKALHDSLHDCSHWFYTRWKDWESWYSQSFGLHFSLREEQWQEDWAFILSLASQPGASLEQT
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) S

GGGTTT





TTSTT



 .........290.........300.........310.........320.........330.........340.........350
Sequence HIFVLAHILRRPIIVYGVKYYKTLGYTRFQGVYLPLLWEQSFCWKSPIALGYTRGHFSALVAMENDDVTI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTS

SS











TTS
GGGS
S

TTB



 .........360.........370.........380.........390.........400.........410.........420
Sequence TFLPLVDSERKLLHVHFLSAQELGNEEQQEKLLREWLDCCVTEGGVLVAMQKSSRRRNHPLVTQMVEKWL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SB
TT

B

BTT

TTT


S

TT

TTTS
 ........
Sequence DRYRQIRP
Predicted secondary structure




SS confidence







Known secondary structure (DSSP) T



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D