Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3zf8A_

Fold library idPDB HeaderMoleculeTitle
c3zf8A_PDB header: transferaseChain: A: PDB Molecule: mannan polymerase complexes subunit mnn9;PDBTitle: crystal structure of saccharomyces cerevisiae mnn9 in2 complex with gdp and mn.


Added to library: Sat Sep 28 08:24:40 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HIAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFITPRTATGDLALKKLE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)





GGG



TTTTTTT

SS

T

S
GGG
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence NAIKKVQTDKKTQRFSKITILRQNSALDVQKERRAAMALARNELLFSTIGPHTSWVLWLNADIIETPPSL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TS
GGGS
S






TT
TT

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence IQDMTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPL
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) TT

STTTT




B


TS
TT



TT
TTTTT
S
B
 .........220.........230.........240.........250.........260.........270.........280
Sequence MAHFYDANGVPGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) GGGG

TTS
TT

SB

SSTT



SS
BTTB
TT

 ........
Sequence VYHIEEEN
Predicted secondary structure


SS confidence







Known secondary structure (DSSP)

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D