Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3wkyB_

Fold library idPDB HeaderMoleculeTitle
c3wkyB_PDB header: oxidoreductase activatorChain: B: PDB Molecule: prophenoloxidase b;PDBTitle: crystal structure of hemolymph type prophenoloxidase (propob) from2 crustacean


Added to library: Sat Apr 26 08:24:24 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DEELRQLFYLPYESTSTLADRLGIQLPPLELSPTAVTVLDPELKAKLGSALSIPEGIPFFAFNKQHSQAV
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
GGGSSTTS
T










TT
TTGGGS
TTS


TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KDLSKVFIEAKSLNVLKDVAIMVKDHVNSAVFLAALYHTYYERKDLSPGDTPPLPTVLPDRFVPTFIINK
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T
SSGGGS

TT

GGGS


GGGTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence AKKLAKSAIINNQTEVVVEWHSDETGLSSRSPEHRVSYWREDMNLNSFHWHWHLSNPYYIEPGDRDRRGE
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT



GGGSS
GGG
GGGGGT
S
TTS
TTSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LFYYMHHNLVARYNMERLSLNLKPVKAFEDWRIPVQDGYFPHLTTGNGQEWSSRQDSTFFQDIREIPLVD
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TT








TTS
BS

B



B
TTS
B


B
SSB



B

SSGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence SNYVSQLEMWRTHLYHGIDVGYLIHENGSYVRLTDNPEVGEDYGINLVGEALEAGDSVNPDVYGNIHNLG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
B
T
TTS


SS

TT


TSS
S
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence HDFLGQSHDPAKKHSTTSGVMGAVETAVRDPVFFRWHKFIDNVFHRYKLTQPPYTPRQLSGNITVLNVTV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTTSTT

S




GGGSTTTGGGSTS





S
 .........430.........440.........450.........460.........470.........480.........490
Sequence QEEHWIDDYVSPENLLHTFFTPKTFNSSSGIDFRLKRDDNITVHIKSNFLEHPDFSYTITVNNPTSDFKR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


STT



TTGGGTS


SSTT






SSS
B
 .........500.........510.........520.........530.........540.........550.........560
Sequence MKLRIFLAPKFDEEGVKMNYASLLRYWTEVDVFETDPIAPGIAYITRHSNESSILSTTAFAFSGCSWPRN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SB
TTS
B

TTT



B
SGGG
TTS





S
SS


GG
 .........570.........580.........590.........600.........610.........620.........630
Sequence LQVPRGTQDGMNFHFFVMATDVSSSFCGRPDQPIPDPWPMGYPLERRSSKATIEDFVDEHPNMMLQEVTI
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) GSS


BSS



TTT

TTS

S

S
TTTTTTS

S
SST
TT
 .........640.........650.....
Sequence THLRDPSSVLRRPISERKECLLFTC
Predicted secondary structure









SS confidence
























Known secondary structure (DSSP)
SSGGGGS


TTT



SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D