Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3wkyB_

Fold library idPDB HeaderMoleculeTitle
c3wkyB_PDB header: oxidoreductase activatorChain: B: PDB Molecule: prophenoloxidase b;PDBTitle: crystal structure of hemolymph type prophenoloxidase (propob) from2 crustacean


Added to library: Sat Apr 26 08:24:24 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DEELRQLFYLPYESTSTLADRLGIQLPPLELSPTAVTVLDPELKAKLGSALSIPEGIPFFAFNKQHSQAV
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
GGGSSTTS
T










TT
TTGGGS
TTS


TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KDLSKVFIEAKSLNVLKDVAIMVKDHVNSAVFLAALYHTYYERKDLSPGDTPPLPTVLPDRFVPTFIINK
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T
SSGGGS

TT

GGGS


GGGTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence AKKLAKSAIINNQTEVVVEWHSDETGLSSRSPEHRVSYWREDMNLNSFHWHWHLSNPYYIEPGDRDRRGE
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT



GGGSS
GGG
GGGGGT
S
TTS
TTSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LFYYMHHNLVARYNMERLSLNLKPVKAFEDWRIPVQDGYFPHLTTGNGQEWSSRQDSTFFQDIREIPLVD
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TT








TTS
BS

B



B
TTS
B


B
SSB



B

SSGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence SNYVSQLEMWRTHLYHGIDVGYLIHENGSYVRLTDNPEVGEDYGINLVGEALEAGDSVNPDVYGNIHNLG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
B
T
TTS


SS

TT


TSS
S
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence HDFLGQSHDPAKKHSTTSGVMGAVETAVRDPVFFRWHKFIDNVFHRYKLTQPPYTPRQLSGNITVLNVTV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTTSTT

S




GGGSTTTGGGSTS





S
 .........430.........440.........450.........460.........470.........480.........490
Sequence QEEHWIDDYVSPENLLHTFFTPKTFNSSSGIDFRLKRDDNITVHIKSNFLEHPDFSYTITVNNPTSDFKR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


STT



TTGGGTS


SSTT






SSS
B
 .........500.........510.........520.........530.........540.........550.........560
Sequence MKLRIFLAPKFDEEGVKMNYASLLRYWTEVDVFETDPIAPGIAYITRHSNESSILSTTAFAFSGCSWPRN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SB
TTS
B

TTT



B
SGGG
TTS





S
SS


GG
 .........570.........580.........590.........600.........610.........620.........630
Sequence LQVPRGTQDGMNFHFFVMATDVSSSFCGRPDQPIPDPWPMGYPLERRSSKATIEDFVDEHPNMMLQEVTI
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) GSS


BSS



TTT

TTS

S

S
TTTTTTS

S
SST
TT
 .........640.........650.....
Sequence THLRDPSSVLRRPISERKECLLFTC
Predicted secondary structure









SS confidence
























Known secondary structure (DSSP)
SSGGGGS


TTT



SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D