Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3wdkA_

Fold library idPDB HeaderMoleculeTitle
c3wdkA_PDB header: ligaseChain: A: PDB Molecule: 4-phosphopantoate--beta-alanine ligase;PDBTitle: crystal structure of 4-phosphopantoate-beta-alanine ligase complexed2 with reaction intermediate


Added to library: Sat Apr 5 08:14:44 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PRYWSLYYREKIIEGMEKGMTAKAGLIAHGRGEAFDYLIGERTIEPAERAMRAAVAKFLLAEHPVISVNG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TT
S
TTSS


SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence NVAALVPKETIELAKALNAKLEINLFYRTEERVRTIAEELRKYDPEIEILGINPTKRIPGERGKVDENGI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TT


TT

TT
TT


SS








TTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence WKADVVLVPLEDGDRTEALVRMGKFVVTVDLNPLSRSARMADITIVDNIVRAYPRMVELAREMKDYSREE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT
S
TT

TT

S
TTSSS
S
TTT

 .........220.........230.........240.........
Sequence LLKIVGEYDNGKTLSDVLLHIRDRLTRLAEEGIWRRKEL
Predicted secondary structure







SS confidence






































Known secondary structure (DSSP)



TT
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D