Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3wdkA_

Fold library idPDB HeaderMoleculeTitle
c3wdkA_PDB header: ligaseChain: A: PDB Molecule: 4-phosphopantoate--beta-alanine ligase;PDBTitle: crystal structure of 4-phosphopantoate-beta-alanine ligase complexed2 with reaction intermediate


Added to library: Sat Apr 5 08:14:44 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PRYWSLYYREKIIEGMEKGMTAKAGLIAHGRGEAFDYLIGERTIEPAERAMRAAVAKFLLAEHPVISVNG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TT
S
TTSS


SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence NVAALVPKETIELAKALNAKLEINLFYRTEERVRTIAEELRKYDPEIEILGINPTKRIPGERGKVDENGI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TT


TT

TT
TT


SS








TTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence WKADVVLVPLEDGDRTEALVRMGKFVVTVDLNPLSRSARMADITIVDNIVRAYPRMVELAREMKDYSREE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT
S
TT

TT

S
TTSSS
S
TTT

 .........220.........230.........240.........
Sequence LLKIVGEYDNGKTLSDVLLHIRDRLTRLAEEGIWRRKEL
Predicted secondary structure







SS confidence






































Known secondary structure (DSSP)



TT
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D