Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3w3jB_

Fold library idPDB HeaderMoleculeTitle
c3w3jB_PDB header: immune systemChain: B: PDB Molecule: toll-like receptor 8;PDBTitle: crystal structure of human tlr8 in complex with cl097


Added to library: Sat Apr 6 09:09:32 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SRSYPCDEKKQVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVGLN
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)



SS



TTS

SS

S


TT


TTS



TTTTTT
TT


TTSS



 .........80.........90.........100.........110.........120.........130.........140
Sequence ITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCYFNK
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)
TTTTTT
TT


TTS

SS

SS

TT
S

SS



TTTTTT
TT
S

SSS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence VCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSG
Predicted secondary structure































































SS confidence





































































Known secondary structure (DSSP)





TTTTTT
TT



SS

SS

SS

TT
S
TTS



TTTTTT
TT


TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence NCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVG
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP) SS


TT
SS




GGG



TTTTTT
TT


TTS

S


GGGGTT
TT


TTS

 .........290.........300.........310.........320.........330.........340.........350
Sequence EIASGAFLTMLPRLEILDLSFNYIKGSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPN
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP) S
GGGGG
TT



S


TT


SS



GGGGG
TT


TT


S
TGGGGGGTT
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence LSTINLGINFIKQIDFKLFQNFSNLEIIYLSENRISPFEFDPHSNFYHFTRPLIKPQCAAYGKALDLSLN
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP)



SS



GGGGGGSSS



SS





S
TTS
SSS

S
SS
TTS

SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence SIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLDL
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP)





TTTTTT



TTS






S
TTTTSTT
S

SS





TTTTTT
TT


 .........500.........510.........520.........530.........540.........550.........560
Sequence SYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDNRY
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)
S
T
TTS



GGGGG
SS


TT





SS



SS


TTS
T
TT

TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence ISIFKGLKNLTRLDLSLNRLKHIPNEAFLNLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLL
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) TTTTTTT



SS

S


TS
TT
S

SS





GGGGGG
TT



SS


 .........640.........650.........660.........670.........680.........690.........700
Sequence FLTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHG
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)


S
GGGT
SS



SS





TT
SS
S
TTS

S


SGGG

S






TT
 .........710.........720.........730.........740......
Sequence NPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSL
Predicted secondary structure




























SS confidence













































Known secondary structure (DSSP)


SGGGT
TTSB
SSGGG
BSTTTTTSBGGG


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D