Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3v44A_

Fold library idPDB HeaderMoleculeTitle
c3v44A_PDB header: immune systemChain: A: PDB Molecule: toll-like receptor 5b and variable lymphocyte receptor b.61PDBTitle: the crystal structure of an immune receptor


Added to library: Sat Mar 3 12:09:34 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ECSVIGYNAICINRGLHQVPELPAHVNYVDLSLNSIAELNETSFSRLQDLQFLKVEQQTPGLVIRNNTFR
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)

TT
TTS

SS




TT



SS



TTTSSS
TT
S



SS


TTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GLSSLIILKLDYNQFLQLETGAFNGLANLEVLTLTQCNLDGAVLSGNFFKPLTSLEMLVLRDNNIKKIQP
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP) T
TT


TT
TT

TTTTTT
TT


TTS


TSSTTTT
TT


TTS


S


 .........150.........160.........170.........180.........190.........200.........210
Sequence ASFFLNMRRFHVLDLTFNKVKSICEEDLLNFQGKHFTLLRLSSITLQDMNEYWLGWEKCGNPFKNTSITT
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
GGGGG
TT


TT

BS


TTTTGGGTT

TT
B
TT
STT
S


TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LDLSGNGFKESMAKRFFDAIAGTKIQSLILSNSYNMGSSFGHTNFKDPDNFTFKGLEASGVKTCDLSKSK
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TTS


TTT


TT
TT
S

SSSTT




TTTTGGGGGS



TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence IFALLKSVFSHFTDLEQLTLAQNEINKIDDNAFWGLTHLKELALDTNQLKSVPDGIFDRLTSLQKIWLHT
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)


TTTTTT
TT


TTS



TTTTTT
TT



SS

S


TTTTTT
TT



S
 .........360.........370.........380.........390.........400.
Sequence NPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPTSASLVPR
Predicted secondary structure






























SS confidence


















































Known secondary structure (DSSP) S
B


TTTTTTTTB
S

BBTTT

BGGG





GGGS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D