Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3un9A_

Fold library idPDB HeaderMoleculeTitle
c3un9A_PDB header: immune systemChain: A: PDB Molecule: nlr family member x1;PDBTitle: crystal structure of an immune receptor


Added to library: Sat Mar 31 12:01:07 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQ
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


S
TTT


TTS


SS
SS

TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence LDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTAAGVAVLMEGLAGN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

TT

SS


STT





SS

T
 .........150.........160.........170.........180.........190.........200.........210
Sequence TSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLHLYFNELS
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) SS


TTSS
GGG
S




SS



SS


TTSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence SEGRQVLRDLGARVVVSLTVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQL
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)







STTS
T


 .........290....
Sequence LRVEGEVRALLEQL
Predicted secondary structure
SS confidence













Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D