Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3ui2A_

Fold library idPDB HeaderMoleculeTitle
c3ui2A_PDB header: transport proteinChain: A: PDB Molecule: signal recognition particle 43 kda protein, chloroplastic;PDBTitle: crystal structure of the cpsrp54 tail bound to cpsrp43


Added to library: Sat Jan 14 22:55:41 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEYETPWWTAARKADEQALSQLLEDRDVD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TTTSS



GGGS
TTT
TTTT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AVDENGRTALLFVAGLGSDKCVRLLAEAGADLDHRDMRGGLTALHMAAGYVRPEVVEALVELGADIEVED
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
B
TTS
BT
TT

TT


SSS


TT
TT

TT


 .........150.........160.........170.........180.........190.........200.........210
Sequence ERGLTALELAREILKTTPKGNPMQFGRRIGLEKVINVLEGQVFEYAEVDEIVEKRGKGKDVEYLVRWKDG
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT


TT


SS




S
TTS
SSS
 .........220.........230....
Sequence GDCEWVKGVHVAEDVAKDYEDGLE
Predicted secondary structure













SS confidence























Known secondary structure (DSSP) S
STTS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D