Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3ud2C_

Fold library idPDB HeaderMoleculeTitle
c3ud2C_PDB header: protein bindingChain: C: PDB Molecule: ankyrin-1;PDBTitle: crystal structure of selenomethionine zu5a-zu5b protein domains of2 human erythrocyte ankyrin


Added to library: Sat Feb 25 11:28:10 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GFLVSFXVDARGGSXRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLSTPPPLAEEEGLASRIIALGPT
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

S
TT


TTT


TTS

S

GGG
SS




TT

S
ST
 .........80.........90.........100.........110.........120.........130.........140
Sequence GAQFLSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEHRSRYGESYLDQILNGXDEELGSLEELEKKRV
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) T



SS
SSSSSSS




SS
GGGTTT
S




T
 .........150.........160.........170.........180.........190.........200.........210
Sequence CRIITTDFPLYFVIXSRLCQDYDIIGPEGGSLKSKLVPLVQATFPENAVTKRVKLALQAQPVPDELVTKL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

S




TT

SS
SS

TTS
SS



 .........220.........230.........240.........250.........260.........270.........280
Sequence LGNQATFSPIVTVEPRRRKFHRPIGLRIPLPPSWTDNPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITGT
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TTS


SSS




SS


SSS
S


STT




BTT
 .........290.........300.........310.........320..
Sequence TKLVYANECANFTTNVSARFWLSDCPRTAEAVNFATLLYKEL
Predicted secondary structure










SS confidence









































Known secondary structure (DSSP) B

TT


SSGGG


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D