Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3tixA_

Fold library idPDB HeaderMoleculeTitle
c3tixA_PDB header: gene regulation/protein bindingChain: A: PDB Molecule: ubiquitin-like protein smt3, rna-induced transcriptionalPDBTitle: crystal structure of the chp1-tas3 complex core


Added to library: Sat Nov 19 19:41:29 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLTFLYDGIEIQADQTPEDLDMEDNDIIE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


SS
TTS
TTT

GGGS
TT

SS

TTTTT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AHREQIGGLPSLPFLACISDFPENHGTSRRSATVSLERVHELFTEHWLSNLKNRREKRQELAEEAVYCRS
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)




TTGGG




SS



GGGG

S
 .........150...
Sequence EMLSQRKLLAAVD
Predicted secondary structure

SS confidence












Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D