Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3t9kA_

Fold library idPDB HeaderMoleculeTitle
c3t9kA_PDB header: protein transportChain: A: PDB Molecule: arf-gap with coiled-coil, ank repeat and ph domain-PDBTitle: crystal structure of acap1 c-portion mutant s554d fused with integrin2 beta1 peptide


Added to library: Wed Jan 9 16:29:29 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GHVVAQVQSVDGNAQCCDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMC
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TSTTTTB
TTT

BS

TTTT
TT
TTT

TTTS


 .........80.........90.........100.........110.........120.........130.........140
Sequence ELGNVIINQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGSLHPGALLFRASGHPP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S
TTTT




TTS
TT
TT

SS







SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence SLPTMADALAHGADVNWVNGGQDNATPLIQATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHT
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TT

TT


TTTT


TT
TT

TT


TTS

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GLACLFLKRGADLGARDSEGRDPLTIAMETANADIVTLLRLAKMREAEAAQGQAGDETYLDIFRDFSLAS
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT

TT


TTS

TT





S




 .
Sequence D
Predicted secondary structure
SS confidence
Known secondary structure (DSSP) -


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D