Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3t8kB_

Fold library idPDB HeaderMoleculeTitle
c3t8kB_PDB header: structural genomics, unknown functionChain: B: PDB Molecule: uncharacterized protein;PDBTitle: the crystal structure of a functionally unknown protein lebu_0176 from2 leptotrichia buccalis c-1013-b


Added to library: Sat Sep 3 10:00:27 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NAXSEYRTVSAAAXLGTYEDFLELFEKGYEDKESVLKSNILYDVLRNNNDEARYKISXFLINKGADIKSR
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
GGGT
SSS
SSS
TTTT
S
TT

TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence TKEGTTLFFPLFQGGGNDITGTTELCKIFLEKGADITALYKPYKIVVFKNIFNYFVDENEXIPLYKLIFS
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TT


TS
TT
TT

SSSTTTTTTGGGGG

S
GGGGT
 .........150.........160.........170.........180...
Sequence QSGLQLLIKDKWGLTALEFVKRCQKPIALKXXEDYIKKYNLKE
Predicted secondary structure






















SS confidence










































Known secondary structure (DSSP) STT


S


TTS

TT
TT



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D