Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3t5oA_

Fold library idPDB HeaderMoleculeTitle
c3t5oA_PDB header: immune systemChain: A: PDB Molecule: complement component c6;PDBTitle: crystal structure of human complement component c6


Added to library: Sat Feb 4 18:23:39 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENFCEQICSKQETRECNWQRCPINCLLGDFGPWS
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP)

GGGS
B





S
SSS
B




TT




S


B








 .........80.........90.........100.........110.........120.........130.........140
Sequence DCDPCIEKQSKVRSVLRPSQFGGQPCTAPLVAFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGE
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)


SSS


B


TT




S
SB




SSSS






SS
TTS
GGGSSSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence NDCGDNSDERDCGRTKAVCTRKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYR
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP)

SSSSGGGTT
SS


SSSS


TTGGGGGTTTT
B
SS


S




TTSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence VPANLENVGFEVQTAEDDLKTDFYKDLTSLGHVPIFYSSKRSENINHNSAFKQAIQASHKKDSSFIRIHK
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP)

TT





GGGS
GGGGG






TTT





TTTSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence VMKVLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDDFGTHYFTSGSLGGVYDLLYQFSSEELKN
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
SSS

B
TTSS
SS


S
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence SGLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWE
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP) T

TS







GGGTSSTTGGGGTT
SGGGSS

BSS
S

 .........430.........440.........450.........460.........470.........480.........490
Sequence KGSSGLEEKTFSEWLESVKENPAVIDFELAPIVDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPN
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) TTSSSSSS


BGGGG

SSTTTT
GGGS

BTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence NGRPTLSGTECLCVCQSGTYGENCEKQSPDYKSNAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGG
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP) TBTT

TTB
STTS

B
SS




B













SSS

S
SS

BSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence KRCEGEKRQEEDCTPCINDDEEDSGCPQPVPPENGFIRNEKQLYLVGEDVEISCLTGFETVGYQYFRCLP
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)



S
S












B





TTS


S
B
TT

TTS


T
 .........640.........650.........660.........670.........680.........690.........700
Sequence DGTWRQGDVECQRTECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNS
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP) TS


S






SSSB
SS

STT

B

TT
SS
S
BTTB
S


TTS
 .........710.........720.........730.........740.........750.........760.........770
Sequence LTCEKDTGHCQLGQKQSGSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLH
Predicted secondary structure































































SS confidence





































































Known secondary structure (DSSP)





TTTTT
STTS




S

STTTTTTGGGT
 .........780.........790.........800.........810.........820.........830.........840
Sequence IGSCQDGRQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKMGSS
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP) SS


ST
TT





SSS



TT

SSS
S


TT


S


B


SSS
 .........850.........860.........870.
Sequence TSEKTLNICEVGTIRCANRKMEILHPGKCLA
Predicted secondary structure






















SS confidence






























Known secondary structure (DSSP)
S

BT


SS




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D