Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3sdeB_

Fold library idPDB HeaderMoleculeTitle
c3sdeB_PDB header: rna binding proteinChain: B: PDB Molecule: non-pou domain-containing octamer-binding protein;PDBTitle: crystal structure of a paraspeckle-protein heterodimer, pspc1/nono


Added to library: Sat Mar 17 13:49:27 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLR
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


SS
GGGS

TT

GGGS
TTTTSSTT
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKAL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T



TTS

TT

TTSS

TTS
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALI
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) S


SSSS









SS


GGGS

STSS
S



TTS
 .........220.........230.........
Sequence EMEKQQQDQVDRNIKEAREKLEMEMEAAR
Predicted secondary structure

SS confidence




























Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D