Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3s8sA_

Fold library idPDB HeaderMoleculeTitle
c3s8sA_PDB header: transcriptionChain: A: PDB Molecule: histone-lysine n-methyltransferase setd1a;PDBTitle: crystal structure of the rrm domain of human setd1a


Added to library: Sat Jun 11 11:47:11 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GQIPLKEVTFARLNDNVRETFLKDMCRKYGEVEEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLT
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

S


S

TT

TTTS

TTT

SSTT
 .........80.........90.........100.......
Sequence SVMGNIIHAQLDIKGQQRMKYYELIVNGSYTPQTVPT
Predicted secondary structure

















SS confidence




































Known secondary structure (DSSP) TT

STTTSS

TTT



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D