Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3rkoL_

Fold library idPDB HeaderMoleculeTitle
c3rkoL_PDB header: oxidoreductaseChain: L: PDB Molecule: nadh-quinone oxidoreductase subunit l;PDBTitle: crystal structure of the membrane domain of respiratory complex i from2 e. coli at 3.0 angstrom resolution


Added to library: Sat Aug 6 10:29:20 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MNMLALTIILPLIGFVLLAFSRGRWSENVSAIVGVGSVGLAALVTAFIGVDFFANGEQTYSQPLWTWMSV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)


TT

S
S
TTS


 .........80.........90.........100.........110.........120.........130.........140
Sequence GDFNIGFNLVLDGLSLTMLSVVTGVGFLIHMYASWYMRGEEGYSRFFAYTNLFIASMVVLVLADNLLLMY
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) SS

TSS
S
TBSBS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LGWEGVGLCSYLLIGFYYTDPKNGAAAMKAFVVTRVGDVFLAFALFILYNELGTLNFREMVELAPAHFAD
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTSTTSTS

B
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GNNMLMWATLMLLGGAVGKSAQLPLQTWLADAMAGPTPVSALIHAATMVTAGVYLIARTHGLFLMTPEVL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
SSST
TTSTTTTS
TTTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence HLVGIVGAVTLLLAGFAALVQTDIKRVLAYSTMSQIGYMFLALGVQAWDAAIFHLMTHAFFKALLFLASG
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TT
SBTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence SVILACHHEQNIFKMGGLRKSIPLVYLCFLVGGAALSALPLVTAGFFSKDEILAGAMANGHINLMVAGLV
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TTS

BSTT



TTT
T
SSSBTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence GAFMTSLYTFRMIFIVFHGKEQIHAHAVKGVTHSLPLIVLLILSTFVGALIVPPLQGVLPQTTELAHGSM
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) SS


S






BTTGGG



TTTT








S
 .........500.........510.........520.........530.........540.........550.........560
Sequence LTLEITSGVVAVVGILLAAWLWLGKRTLVTSIANSAPGRLLSTWWYNAWGFDWLYDKVFVKPFLGIAWLL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) SS

STGGGTT
 .........570.........580.........590.........600.........610..
Sequence KRDPLNSMMNIPAVLSRFAGKGLLLSENGYLRWYVASMSIGAVVVLALLMVL
Predicted secondary structure




SS confidence



















































Known secondary structure (DSSP) SS
TT





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D