Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3rgxA_

Fold library idPDB HeaderMoleculeTitle
c3rgxA_PDB header: transferaseChain: A: PDB Molecule: protein brassinosteroid insensitive 1;PDBTitle: structural insight into brassinosteroid perception by bri1


Added to library: Sun Jun 19 00:19:28 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLYREIHQLISFKDVLPDKNLLPDWSSNKNPCTFDGVTCRDDKVTSIDLSSKPLNVGFSAVSSSLLSLTG
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
T
S
TTSSTT

SSS
GGGSTTTT
TT



TTT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGL
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)


TTS








TT



SSGGGGGGGGG
TT



SS

S


S

 .........150.........160.........170.........180.........190.........200.........210
Sequence KLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)

TT
S

SSB
STT

SS



SSS

B
TT
TT



SS


S


B
 .........220.........230.........240.........250.........260.........270.........280
Sequence LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDF
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TT

S



SS


S
TT
TT



SS

S





TT



SS


GG
 .........290.........300.........310.........320.........330.........340.........350
Sequence LSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGE
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP) GGGGTTT



SS


GGGGG

S



SSS

TT
TT



SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP)

TTTTT
S

SS


TTTT
STT





SS
S


GGGGG
TT



SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLS
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)


S


GGGGG
TT



SS


S


GGGGG
TT



SS


S


GGGGG
TT



 .........500.........510.........520.........530.........540.........550.........560
Sequence NNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAAN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) SS


S


GGGGG
TT



SS



GGGGG
TT



SSSB

GGGGTTSS
B


 .........570.........580.........590.........600.........610.........620.........630
Sequence FRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYSPTFDNNGSMMFLDMSYNMLSG
Predicted secondary structure































































SS confidence





































































Known secondary structure (DSSP)



S

SS

SS
SS

GGGGGGGGGT

S








SS
B




SS

 .........640.........650.........660.........670.........680.........690.........700
Sequence YIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNL
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

GGGG

TT



SSSB

GGGGG
TT
S

SS




GGGGG



S

SS
 .........710.........720.........730....
Sequence SGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDP
Predicted secondary structure


























SS confidence

































Known secondary structure (DSSP)


SSTTGGGS
GGGG
S
TTSTTS





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D