Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3rg1I_

Fold library idPDB HeaderMoleculeTitle
c3rg1I_PDB header: immune systemChain: I: PDB Molecule: cd180 molecule;PDBTitle: crystal structure of the rp105/md-1 complex


Added to library: Sat Sep 3 10:17:54 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PKCTEKEGNRTYNCENLGLREIPDTLPNTTEVLEFSFNFLPTIQNTTFSRLINLIFLDLTRCQINWVHED
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)


TTT
TTS

SS

TTS
TT



S


S
TTTTSS
TT
S
TTS



TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TFQSHHQLNTIVLTGNPLIFMAETSLTGPKFLKHLFLTQTGISNLEFIPVHNLENLESLHLGSNHISSIN
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP) TTTT
TT


TT




TTTT


S



TTS



GGGS

TT
TT
S
TTS





 .........150.........160.........170.........180.........190.........200.........210
Sequence LPENFPTQNLKVLDFQNNAIHYISRKDTNSLEQATNLSLNFNGNDIKGIEPGAFISKIFQSLKFGGSLNL
Predicted secondary structure
































































SS confidence





































































Known secondary structure (DSSP)

TT


TT



SS



TTTT
SS
TT




TTTT
STT
TT
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence FIIFKGLQNSTLQSLWLGTFEDTDDQYLTSATFEGLCDMSVESINLQKHRFSDLSSSTFRCFTRVQELDL
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP) TTT




TTS



B
GGGGGGGGGS
TT

BSS

GGGGTT
TT


 .........290.........300.........310.........320.........330.........340.........350
Sequence TAAHLNGLPSGIEGMNSLKKLVLNANSFDQLCQINAASFPSLRDLYIKGNMRKLDLGTRCLEKLENLQKL
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP) TT


S


S

STTTT


TT


SBGGGG
GGG
TT



S
SS

B

SSTTTT
TT

 .........360.........370.........380.........390.......
Sequence DLSHSDILQYLNLSYNEPLELLDVAFVLNLSHLNLQILILSHLDLSH
Predicted secondary structure







































SS confidence














































Known secondary structure (DSSP)
TTS





S





















Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D