Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3rg1B_

Fold library idPDB HeaderMoleculeTitle
c3rg1B_PDB header: immune systemChain: B: PDB Molecule: cd180 molecule;PDBTitle: crystal structure of the rp105/md-1 complex


Added to library: Thu Jan 10 14:21:09 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KCTEKEGNRTYNCENLGLREIPDTLPNTTEVLEFSFNFLPTIQNTTFSRLINLIFLDLTRCQINWVHEDT
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)

TTT
TTS

SS

TTS
TT



S


S
TTTTSS
TT
S
TTS



TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence FQSHHQLNTIVLTGNPLIFMAETSLTGPKFLKHLFLTQTGISNLEFIPVHNLENLESLHLGSNHISSINL
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP) TTT
TT


TT




TTTT


S



TTS



GGGS

TT
TT
S
TTSS





 .........150.........160.........170.........180.........190.........200.........210
Sequence PENFPTQNLKVLDFQNNAIHYISRKDTNSLEQATNLSLNFNGNDIKGIEPGAFISKIFQSLKFGGSLNLF
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)
TT


TT



SS



TTTT
SS
TT




TTTT
STT
TT
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence IIFKGLQNSTLQSLWLGTFEDTDDQYLTSATFEGLCDMSVESINLQKHRFSDLSSSTFRCFTRVQELDLT
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) T
S




TTS



B
GGGGGGGGGS
TT

BSS

GGGGTT
TT
S
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence AAHLNGLPSGIEGMNSLKKLVLNANSFDQLCQINAASFPSLRDLYIKGNMRKLDLGTRCLEKLENLQKLD
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) T


S


S

STTTT


TT


SBGGGG
GGG
TT


TT
SS
BB

SSSSTT
TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence LSHSDIEASDCCNLQLKNLRHLQYLNLSYNEPLGLEDQAFKECPQLELLDVAFTHLHVKAPHSPFQNLHL
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TTS
B
STTTTTT
TT



S
S

TTTTTT
TT


TT



TT

TTTT
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence LRVLNLSHCLLDTSNQHLLAGLQDLRHLNLQGNSFQDGSISKTNLLQMVGSLEILILSSCNLLSIDQQAF
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP)


TTS

BTT
TTSSTT
TT


TT
B
GGG
SS
TTTT
TT
S
TTS



TTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence HGLRNVNHLDLSHNSLTGDSMDALSHLKGLYLNMASNNIRIIPPHLLPALSQQSIINLSHNPLDCTCSNI
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) TT

S



SS


GGGGGGGTT

S


SS





GGGTSS

SS

SGGG
 .........570.........580.........590.........
Sequence HFITWYKENLHKLEDSEETTCANPPSLRGVKLSDVKLHC
Predicted secondary structure


















SS confidence






































Known secondary structure (DSSP) TGGGBTTGGG
BSGGGTT
BGGG





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D