Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3rfsA_

Fold library idPDB HeaderMoleculeTitle
c3rfsA_PDB header: protein bindingChain: A: PDB Molecule: internalin b, repeat modules, variable lymphocyte receptorPDBTitle: design of a binding scaffold based on variable lymphocyte receptors of2 jawless vertebrates by module engineering


Added to library: Sat Mar 17 12:01:29 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALG
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)


S
S
ST
S
TTS
TT


TTS




TTGGG
TT


T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLNLA
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TS




GGGTT
TT


TTS





TTTTTT
TT


TTS





TTTTTT
TT



 .........150.........160.........170.........180.........190.........200.........210
Sequence HNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPEGVFDKLTQLKDLRLYQNQLKSVPDGVFDRLTSLQYIW
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP) SS





TTTTTT
TT



SS





TTTTTT
TT



SS

S


TTTTTT
TT

 .........220.........230.........240.........250.........260...
Sequence LHDNPWDCTCPGIRYLSEWINKHSGVVRNSAGSVAPDSAKCSGSGKPVRSIIC
Predicted secondary structure




































SS confidence




















































Known secondary structure (DSSP)

SS
B


TTTTTGGGBB
TTS
B
GGGSBBTTT

BGGG



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D