Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3pvcA_

Fold library idPDB HeaderMoleculeTitle
c3pvcA_PDB header: oxidoreductase, transferaseChain: A: PDB Molecule: trna 5-methylaminomethyl-2-thiouridine biosynthesisPDBTitle: crystal structure of apo mnmc from yersinia pestis


Added to library: Sat Apr 16 09:16:32 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FSNEDGLEETHHVFLKGNGFPARFASHPQQSCIFAETGFGTGLNFLTLWRDFALFRQQSPNATLRRLHYI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

STTSTTTTTTTT

SS

TTS
TTSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence SFEKYPLHVADLASAHARWPELASFAEQLRAQWPLPLAGCHRILLADGAITLDLWFGDVNTLLPTLDDSL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SS


TT
GGGT




STTTTS
GGG

GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence NNQVDAWFLDGFAPNPDXWNEQLFNAXARXTRPGGTFSTFTAAGFVRRGLQQAGFNVTKVKGFGQKREXL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT

SS



TT
SS


TT

SSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence TGTLPQQIHAPTAPWYHRPAATRCDDIAIIGGGIVSALTALALQRRGAVVTLYCADAQPAQGASGNRQGA
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)

S






GGG




S

SS

STTT

SSSSTT
SGGG
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence LYPLLNGKNDALETFFTSAFTFARRQYDQLLEQGIAFDHQWCGVSQLAFDDKSRGKIEKXLHTQWPVEFA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)




SS
STT








STTS


TTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence EAXSREQLSELAGLDCAHDGIHYPAGGWLCPSDLTHALXXLAQQNGXTCHYQHELQRLKRIDSQWQLTFG
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
SS

SS
TT

TT
S


SSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence SQAAKHHATVILATGHRLPEWEQTHHLPLSAVRGQVSHIPTTPVLSQLQQVLCYDGYLTPVNPANQHHCI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



S

GGGTT
STTTTTS



TTGGG

SSSS


BTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence GASYQRGDIATDFRLTEQQENRERLLRCLPQVSWPQQVDVSDNQARCGVRCAIRDHLPXVGAVPDYAATL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)


TB






TT
SGGGG


TT


TTS


 .........570.........580.........590.........600.........610.........620.........630
Sequence AQYQDLSRRINDIAVAPVWPELFXVGGLGSRGLCSAPLVAEILAAQXFGEPLPLDAKTLAALNPNRFWIR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) STT









TT
TT


SS
TT
TT
 .....
Sequence KLLKG
Predicted secondary structure



SS confidence




Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D