Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3pilA_

Fold library idPDB HeaderMoleculeTitle
c3pilA_PDB header: oxidoreductaseChain: A: PDB Molecule: peptide methionine sulfoxide reductase;PDBTitle: crystal structure of mxr1 from saccharomyces cerevisiae in reduced2 form


Added to library: Sat Feb 26 08:40:51 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSSLISKTIKYDPAKDKLITLACGCFWGTEHMYRKYLNDRIVDCKVGYANGEESKKDSPSSVSYKRVCGG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)



S
SSS


TTT
SSTTTSSS

GGG
SBTTB

TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence DTDFAEVLQVSYNPKVITLRELTDFFFRIHDPTTSNSQGPDKGTQYRSGLFAHSDADLKELAKIKEEWQP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
S


TTTS
TTSS
TTSSSTTSGGG
SSGG
 .........150.........160.........170.........180...
Sequence KWGNKIATVIEPIKNFYDAEEYHQLYLDKNPQGYACPTHYLRE
Predicted secondary structure
























SS confidence










































Known secondary structure (DSSP) GGTT








GGGTT
TTS


TT
S



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D