Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3opyB_

Fold library idPDB HeaderMoleculeTitle
c3opyB_PDB header: transferaseChain: B: PDB Molecule: 6-phosphofructo-1-kinase beta-subunit;PDBTitle: crystal structure of eukaryotic phosphofructokinase from yeast pichia2 pastoris with a unique gamma subunit and glyoxalase subdomains in3 alpha and beta subunits


Added to library: Tue Oct 19 11:45:04 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLFNGTSFITLFAPNSLQASIDFYTNFLGFAIRKNSNQKLQLEEDQNNVSIQLILDPEHAASVSQIDQNI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

S









TT


SS
S




TTS


SS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RNLTIQSNIAFKSSSLSKLVKLLKDGGHPVQQSPNEISPFEVYTVDPLGSLIGFGFKNPFAVNERVRKTI
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)







S
TTT


B
SSSS
S


SS





SSS









 .........150.........160.........170.........180.........190.........200.........210
Sequence GVMTSGGDSPGMNPFVRAVVRAGIYKGCKVFCIHEGYEGLVRGGEKYIKETQWHDVRGWLVEGGTNIGTA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
SS

TTTT

TT
STTT
GGGGTTTTT

S
SS


 .........220.........230.........240.........250.........260.........270.........280
Sequence RCKEFRERSGRLKACKNMIDMGIDALIVCGGDGSLTGADRFRSEWPSLIEEQQQFNTHQNLNICGAVGSI
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

SGGGST


T







T
S
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence DNDMSSTDATIGAFSSLDRICRAIDYIDATASHSRAFIVEVMGRHCGWLGLLAGLATSADYILIPEKPAS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S


SS
SS
S



S


SS

TT
S
TTS


 .........360.........370.........380.........390.........400.........410.........420
Sequence SREWQDQMCDIVGKHRARGKRKTIVIVAEGAISNDLSPISCDQVKDVLVNRLGLDTRVTTLGHVQRGGTA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SS
T



TT
B
TT

B

TS


GGGGT
S

 .........430.........440.........450.........460.........470.........480.........490
Sequence VAFDRIYATLQGVEAVNAVLECDADTPSPMIAIKEDQITRVPLVDAVELTQQVAKSIESRNFKKAISLRD
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)


TTS

SSS
TT
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence SEFVEHMKNFISTNSDHVPPSLPLEKRKKIAIINVGAPAGGMNSAVYSMATYCMSRGHVPYAIHNGFSGL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


S

SS
GGG

SS

TTT
TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence ARHESVRSINWLDIEGWGSLGGSEIGTNRTLPNDADIGMIAYFFEKYGFDGLILVGGFEAFISLHQLERA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)



TTTTTTGGG

S
SS



TTTS
TT
SSG
 .........640.........650.........660.........670.........680.........690.........700
Sequence RINYPSLRIPLVLIPATISNNVPGTEYSLGSDTCLNSFMEYCDVIKQSAAATNRVFVVEVQGGNSGYIAT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) GGT
GGG
S
B
SS


TT
S

BT


STT

 .........710.........720.........730.........740.........750.........760.........770
Sequence HAQLACGAQISYVPEEGISLAQLEMDINSLKESFANDQGKTKSGRLILKSENASKVLTTEVISTIIDDEA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T
S
TTT


T
TTS



GGG
SSS
 .........780.........790.........800.........810.........820.........830.........840
Sequence SGRFDSKTAIPGHVQQGGIPSPMDRVRASRFAIRAVSFIERHSDRCQTFKNSISFRQTDEITSTAVVLGI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTSS


TTTT
SS

S
S




TT
 .........850.........860.........870.........880....
Sequence HKQLRFTPIRQLYDFESDVPRRMRNIFWSNVREISDMLSGRTSL
Predicted secondary structure















SS confidence











































Known secondary structure (DSSP)


TS

TTTT



STT




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D