Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3ojyB_

Fold library idPDB HeaderMoleculeTitle
c3ojyB_PDB header: immune systemChain: B: PDB Molecule: complement component c8 beta chain;PDBTitle: crystal structure of human complement component c8


Added to library: Sat Apr 16 09:00:04 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQT
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)

B










BTTTT


TT




S
S









S

SS
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGC
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)


GGGTTSSS

SSSS
TTSS
SS
SS

SS

B

TTGGGGG
TTT


B
TT


S

 .........150.........160.........170.........180.........190.........200.........210
Sequence SPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTESGFSFGFKIPGIFELGISSQSDRG
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TT
TT






SSTTTS




BTTTB

S



TTTSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence KHYIRRTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYI
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TT
S



SSS

B
TT

SS


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence TEAVLGGIYEYTLVMNKEAMERGDYTLNNVHACAKNDSVGKCRGILNEIKDRNKRDMVEDLVVLVRGGAS
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)

TTTT

TTT


S

TTTTTTTT




S

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence EHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMKQALEEFQKEVSS
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TT




TSSS


S
TS
GGGG

TTT
TTT
G
 .........430.........440.........450.........460.........470.........480.........490
Sequence CHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPP
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) GGS


STT
TT

TTTGGG
SSSS














SSS

TTTT

S
 .........500...
Sequence PQNSGPASETLDC
Predicted secondary structure












SS confidence












Known secondary structure (DSSP) S




S


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D