Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3ojaB_

Fold library idPDB HeaderMoleculeTitle
c3ojaB_PDB header: protein bindingChain: B: PDB Molecule: anopheles plasmodium-responsive leucine-rich repeat proteinPDBTitle: crystal structure of lrim1/apl1c complex


Added to library: Sat Sep 25 10:59:14 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PRQPEYKCIDSQYDCVFYDVHIDMQTQDVYFGFEDITLNNQKIVTFKNSTMRKLPAALLDSFRQVELLNL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)


S






S
S

SS



S
SSGGG


SSS
S
T



S
 .........80.........90.........100.........110.........120.........130.........140
Sequence NDLQIEEIDTYAFAYAHTIQKLYMGFNAIRYLPPHVFQNVPLLTVLVLERNDLSSLPRGIFHNTPKLTTL
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) TTS



TTTTTT
TT



SS





TTTTTT
TT



SS





TTTTTT
TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence SMSNNNLERIEDDTFQATTSLQNLQLSSNRLTHVDLSLIPSLFHANVSYNLLSTLAIPIAVEELDASHNS
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

SS


B

TTTTTT
TT


TTS

SB

GGG
TT
S

SS

S

TT
S

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence INVVRGPVNVELTILKLQHNNLTDTAWLLNYPGLVEVDLSYNELEKIMYHPFVKMQRLERLYISNNRLVA
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP)


S

S




SS




GGGGG
TT
S

SS


SGGGTT
SS


TTS


 .........290.........300.........310.........320.........330.........340.........350
Sequence LNLYGQPIPTLKVLDLSHNHLLHVERNQPQFDRLENLYLDHNSIVTLKLSTHHTLKNLTLSHNDWDCNSL
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
SSS

TT



SS




GGGTT
S

SS







TT


S

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence RALFRNVARPAVDDADQHCKIDYQLEHGLCCKESDKPYLDRLLQYIALTSVVEKVLEAEVNELRAEVQQL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTT

TTTB







TT
TT

SST


 .........430.........440.........450.........460.........470.........480.........490
Sequence TNEQIQQEQLLQGLHAEIDTNLRRYRLPKDGLARSSDNLNKVFTHLKERQAFKLRETQARRTEADAKQKE
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TT



SSS
 .........500.........510.........520.........530....
Sequence TEDLEQENIALEKQLDNKRAKQAELRQETSLKRQKVKQLEAKKN
Predicted secondary structure
SS confidence











































Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D