Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3ojaA_

Fold library idPDB HeaderMoleculeTitle
c3ojaA_PDB header: protein bindingChain: A: PDB Molecule: leucine-rich immune molecule 1;PDBTitle: crystal structure of lrim1/apl1c complex


Added to library: Sat Sep 25 11:40:45 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AIHEIKQNGNRYKIEKVTDSSLKQALASLRQSAWNVKELDLSGNPLSQISAADLAPFTKLELLNLSSNVL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)


TTS

TTTTTSTTGGG



SS





GGGGTT
TT


TTS

 .........80.........90.........100.........110.........120.........130.........140
Sequence YETLDLESLSTLRTLDLNNNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANNKITMLRDLDE
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP)
TT
TT



SS
TT



SS






SS


SS


SGGGB
G
 .........150.........160.........170.........180.........190.........200.........210
Sequence GCRSRVQYLDLKLNEIDTVNFAELAASSDTLEHLNLQYNFIYDVKGQVVFAKLKTLDLSSNKLAFMGPEF
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP) GGGSS
TTS


GGGGGGGTTT


TTS







TT



SS



GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence QSAAGVTWISLRNNKLVLIEKALRFSQNLEHFDLRGNGFHCGTLRDFFSKNQRVQTVAKQTVKKLTGQNE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) GGGTT
S
TTS



TT



TT


TT

B
TT
TSSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence EECTVPTLGHYGAYCCEDLPAPFADRLIALKRKEHALLSTERLECERENQARQREIDALKEQYRTVIDQV
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP)


SSTT
TT


S

S


T




 .........360.........370.........380.........390.........400.........410.........420
Sequence TLRKQAKITLEQKKKALDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQLLRAIVKRYEEMYVE
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TTSS




SS


 .........430.........440.........450.........460.........470.........480..
Sequence QQSVQNNAIRDWDMYQHKETQLAEENARLKKLNGEADLALASANATLQELVVREQNLASQLG
Predicted secondary structure
SS confidence





























































Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D