Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3ogmB_

Fold library idPDB HeaderMoleculeTitle
c3ogmB_PDB header: protein bindingChain: B: PDB Molecule: coronatine-insensitive protein 1;PDBTitle: structure of coi1-ask1 in complex with coronatine and the jaz1 degron


Added to library: Tue Oct 19 11:44:25 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SCVATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMALCYTATPDRLSRRFPNLRSLKLK
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)




STTTTT


TTS


S
GGGS

TT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence GKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSDLDLDRLAKARADDLETLKLDKCSGF
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)
S
GGGGGT
S
GGG

B

TT

S
B

GGG

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence TTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRS
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)
TT
S
TT



S






S



S


TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LVSVKVGDFEILELVGFFKAAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPF
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)


SS

GGGG
TT







TT
TTSSS




TT

TT

TTTGGGGGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence AAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETRNVIGDRGLEVLAQYCKQLKRLRIERGADEQGMEDE
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TTT

TT



TT
TT

GGG
SS





SSSSSSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence EGLVSQRGLIALAQGCQELEYMAVYVSDITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) S


B
TT
SSB


TT


TT
SS
SS


 .........430.........440.........450.........460.........470.........480.........490
Sequence LIGCKKLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYVGESDEGLMEFSRGCPNLQKLEMRGCCFS
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
TT



GGG


SS


S

SST

TT

S


B
 .........500.........510.........520.........530.........540.........550.........560
Sequence ERAIAAAVTKLPSLRYLWVQGYRASMTGQDLMQMARPYWNIELIPSRREHPAHILAYYSLAGQRTDCPTT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
SS



B

SS
TTGGGG

TT








SS
S
S


TT
 ........
Sequence VRVLKEPI
Predicted secondary structure



SS confidence







Known secondary structure (DSSP)


S


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D