Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3o8oB_

Fold library idPDB HeaderMoleculeTitle
c3o8oB_PDB header: transferaseChain: B: PDB Molecule: 6-phosphofructokinase subunit beta;PDBTitle: structure of phosphofructokinase from saccharomyces cerevisiae


Added to library: Sat Feb 5 09:12:56 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PQKAIAVMTSGGDAPGMNSNVRAIVRSAIFKGCRAFVVMEGYEGLVRGGPEYIKEFHWEDVRGWSAEGGT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


SS

TTT
TTS
STTT
GGGGTTGGG

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence NIGTARCMEFKKREGRLLGAQHLIEAGVDALIVCGGDGSLTGADLFRSEWPSLIEELLKTNRISNEQYER
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TT




SGGGST


TTSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence MKHLNICGTVGSIDNDMSTTDATIGAYSALDRICKAIDYVEATANSHSRAFVVEVMGRNCGWLALLAGIA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T


B
TT


TT
S

BTTT


TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence TSADYIFIPEKPATSSEWQDQMCDIVSKHRSRGKRTTIVVVAEGAIAADLTPISPSDVHKVLVDRLGLDT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T
S
TT



TTTT


TT
B
TTS
B

TT


 .........290.........300.........310.........320.........330.........340.........350
Sequence RITTLGHVQRGGTAVAYDRILATLQGLEAVNAVLESTPDTPSPLIAVNENKIVRKPLMESVKLTKAVAEA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
GGGGT
S




TTS

SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence IQAKDFKRAMSLRDTEFIEHLNNFMAINSADHNEPKLPKDKRLKIAIVNVGAPAGGINSAVYSMATYCMS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT
S
TTTTSSTT
SSSS


SS

TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence QGHRPYAIYNGWSGLARHESVRSLNWKDMLGWQSRGGSEIGTNRVTPEEADLGMIAYYFQKYEFDGLIIV
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T
TT



GGGGTTGGG

S
TT





GGGG
T
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence GGFEAFESLHQLERARESYPAFRIPMVLIPATLSNNVPGTEYSLGSDTALNALMEYCDVVKQSASSTRGR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) STTTTT
GGG
S


B
TT


SS
S

BTSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence AFVVDCQGGNSGYLATYASLAVGAQVSYVPEEGISLEQLSEDIEYLAQSFEKAEGRGRFGKLILKSTNAS
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

TT

T
S
TTT


TT
TT

GGG
 .........640.........650.........660.........670.........680.........690.........700
Sequence KALSATKLAEVITAEADGRFDAKPAYPGHVQQGGLPSPIDRTRATRMAIKAVGFIKDNQAAIAEARAAEE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SS

TTS


GGGGG
SS

TSSSSSS
 .........710.........720.........730.........740.........750.........760...
Sequence NFNADDKTISDTAAVVGVKGSHVVYNSIRQLYDYETEVSMRMPKVIHWQATRLIADHLVGRKR
Predicted secondary structure




























SS confidence






























































Known secondary structure (DSSP) TT



TTS
SSS

TB
GGGSSBSS
S
T



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D