Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3o6nA_

Fold library idPDB HeaderMoleculeTitle
c3o6nA_PDB header: protein bindingChain: A: PDB Molecule: apl1;PDBTitle: crystal structure of apl1 leucine-rich repeat domain


Added to library: Sat Sep 25 09:27:26 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QPEYKCIDCVFYDVHIDMQTQDVYFGFEDITLNNQKIVTFKNSTMRKLPAALLDSFRQVELLNLNDLQIE
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)


B

S

SS



S
SSGGG


SS
S
T



S
TTS


 .........80.........90.........100.........110.........120.........130.........140
Sequence EIDTYAFAYAHTIQKLYMGFNAIRYLPPHVFQNVPLLTVLVLERNDLSSLPRGIFHNTPKLTTLSMSNNN
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP)
TTTTTT
TT



SS





TTTTTT
TT



SS





TTTTTT
TT



SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LERIEDDTFQATTSLQNLQLSSNRLTHVDLSLIPSLFHANVSYNLLSTLAIPIAVEELDASHNSINVVRG
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

B

TTTTSS
TT



SS

SB

GGG
TT
S

SS

S

SS
S

SS



 .........220.........230.........240.........250.........260.........270.........280
Sequence PVNVELTILKLQHNNLTDTAWLLNYPGLVEVDLSYNELEKIMYHPFVKMQRLERLYISNNRLVALNLYGQ
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP)


SS



SS




GGGGG
TT
S

SS


SGGGTT
SS



SS



SSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence PIPTLKVLDLSHNHLLHVERNQPQFDRLENLYLDHNSIVTLKLSTHHTLKNLTLSHNDWDCNSLRALFRN
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)

TT



SS




GGGTT
S

SS







TT


S

SS
TTT
 .........360.........370........
Sequence VARPAVDDADQHCKIDYQLEHGLCCKES
Predicted secondary structure



















SS confidence



























Known secondary structure (DSSP)

TTTB



S


TT
TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D