Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3o14B_

Fold library idPDB HeaderMoleculeTitle
c3o14B_PDB header: gene regulationChain: B: PDB Molecule: anti-ecfsigma factor, chrr;PDBTitle: crystal structure of an anti-ecfsigma factor, chrr (maqu_0586) from2 marinobacter aquaeolei vt8 at 1.70 a resolution


Added to library: Sat Sep 18 08:54:43 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GXEINADFTKPVVIDTDQLEWRPSPXKGVERRXLDRIGGEVARATSIVRYAPGSRFSAHTHDGGEEFIVL
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


BS

TTS
GGGS


SSTTSSSS

TT



SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence DGVFQDEHGDYPAGTYVRNPPTTSHVPGSAEGCTIFVKLWQFDPADRTQFSKNXEAELGAPVEGISTSLL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTTT
TT


SS
S
S
TT



TGGG



BTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence HEDERETVTHRKLEPGANLTSEAAGGIEVLVLDGDVTVNDEVLGRNAWLRLPEGEALSATAGARGAKIWX
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
SS

TT


SS
TT
TT
TT

 .........220..
Sequence KTGHLRFVRTPE
Predicted secondary structure









SS confidence











Known secondary structure (DSSP) SGGGG





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D