Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3nxkE_

Fold library idPDB HeaderMoleculeTitle
c3nxkE_PDB header: hydrolaseChain: E: PDB Molecule: cytoplasmic l-asparaginase;PDBTitle: crystal structure of probable cytoplasmic l-asparaginase from2 campylobacter jejuni


Added to library: Sun Aug 29 03:38:10 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KSRIAILGTGGTIAGFAIDIDVLIKAVPQIRDLADISWEQIANIDSSNXCDEIWLRLAKKIAKLFAEGID
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

SSTT




TTSSTT

GGG

TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence GVVITHGTDTXEETAYFLNLTIKSDKPVVLVGAXRPSTAISADGPKNLYNAVALVVNKEAKNKGVXVAIN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

SSS



S


SS
TTSTT
SSGGGTTS
ST
 .........150.........160.........170.........180.........190.........200.........210
Sequence DKILSARGVVKTHSLNVDAFSSPDFGDLGYIVDGKVFFYNNVIKAHTKNAPFDVSKLTSLPKVDILYSYS
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TTTT


SSSS


TTT

STT




S

GGGS



TT
S





T
 .........220.........230.........240.........250.........260.........270.........280
Sequence NDGSGVAAKALFEHGTKGIVVAGSGAGSIHKNQKDVLKELLKKGLKVVVSSRVVAGCVAVSDSDEKLGFI
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T

TT

BTTTB

TTT
SSSSS




T
 .........290.........300.........310....
Sequence SAEDLNPQKARVLLXLALTKTSDPKKIQEYFLKY
Predicted secondary structure









SS confidence

































Known secondary structure (DSSP)
TT

TTT




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D