Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3nhnA_

Fold library idPDB HeaderMoleculeTitle
c3nhnA_PDB header: transferaseChain: A: PDB Molecule: tyrosine-protein kinase hck;PDBTitle: crystal structure of the src-family kinase hck sh3-sh2-linker2 regulatory region


Added to library: Sat Sep 4 08:53:35 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGI
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

SS
B


STT


B
TT
TTTTT

GGG

S
TTSTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
STT

SS

TTSTT
TTT
TTS
SSTT
SS
 .........150.........160...
Sequence QELVDHYKKGNDGLCQKLSVPCM
Predicted secondary structure













SS confidence






















Known secondary structure (DSSP) TTT

TTSSS


SB


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D