Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3ml6D_

Fold library idPDB HeaderMoleculeTitle
c3ml6D_PDB header: protein transportChain: D: PDB Molecule: chimeric complex between protein dishevlled2 homolog dvl-2PDBTitle: a complex between dishevlled2 and clathrin adaptor ap-2


Added to library: Sat Aug 28 15:54:00 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRH
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

STTSSS



SS

T

S
SSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence TVNKITFSEQCYYVFGDLSGPQPPPYHELEFGGSGGSRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVM
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SSS
SS

SSS











TT




TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KSYLSGMPECKFGMNDCTFHQCVRLSRSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SS





B
TT





S
SS


STTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence VVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
S
TT



TTSSSGGGT
SS

 .........290.........300.........310.........320.........330......
Sequence TWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC
Predicted secondary structure



























SS confidence























































Known secondary structure (DSSP)






SS
TT



SSSS

GGG


B



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D