Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3mkuA_

Fold library idPDB HeaderMoleculeTitle
c3mkuA_PDB header: transport proteinChain: A: PDB Molecule: multi antimicrobial extrusion protein (na(+)/drugPDBTitle: structure of a cation-bound multidrug and toxin compound extrusion2 (mate) transporter


Added to library: Thu Oct 7 15:21:33 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ENSVHRYKKEASNLIKLATPVLIASVAQTGMGFVDTIMAGGVSAIDMAAVSIAASIWLPSILFGVGLLMA
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP)
TTTTTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LVPVVAQLNGAGRQHKIPFEVHQGLILALLVSVPIIAVLFQTQFIIRFMDVEEAMATKTVGYMHAVIFAV
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) GGG
TTS
SSSSSSS
SS
SSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence PAYLLFQALRSFTDGMSLTKPAMVIGFIGLLLNIPLNWIFVYGKFGAPELGGVGCGVATAIVYWIMLLLL
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TTTT
TTS


TT
SS



 .........220.........230.........240.........250.........260.........270.........280
Sequence LFYIVTSKRLAHVKVFETFHKPQPKELIRLFRLGFPVAAALFFEVTLFAVVALLVAPLGSTVVAAHQVAL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) T
TT










SSTTTSTTTTT

S
STTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence NFSSLVFMFPMSIGAAVSIRVGHKLGEQDTKGAAIAANVGLMTGLATACITALLTVLFREQIALLYTENQ
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) GGGSS


TTTTTSS
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence VVVALAMQLLLFAAIYQCMDAVQVVAAGSLRGYKDMTAIFHRTFISYWVLGLPTGYILGMTNWLTEQPLG
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TTGGGSSSSS

S
 .........430.........440.........450.........460
Sequence AKGFWLGFIIGLSAAALMLGQRLYWLQKQSDDVQLHLAAK
Predicted secondary structure




SS confidence







































Known secondary structure (DSSP) TGGGSTTT

SS
TTTTTSS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D