Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3madA_

Fold library idPDB HeaderMoleculeTitle
c3madA_PDB header: lyaseChain: A: PDB Molecule: sphingosine-1-phosphate lyase;PDBTitle: crystal structure of stspl (symmetric form)


Added to library: Wed Jan 9 16:23:59 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KPYRDRFPSHARLPRAGLPRAEILAEIAAMGAAESPAWRDGYASGAVYHGDEHHIAFLNEVYALQSQSNP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTTTTS


SS

SS


TT
BSSS
S


TT

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence LHPDLWPSTAKFEAEVVAMTAHMLGGDAAGGTVCGTVTSGGTESLLLAMKTYRDWARATKGITAPEAVVP
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T
TTT
TTGGGGTS

SS

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence VSAHAAFDKAAQYFGIKLVRTPLDADYRADVAAMREAITPNTVVVAGSAPGYPHGVVDPIPEIAALAAEH
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTS
TT

B
TTS
B


TTTT
TTT




 .........220.........230.........240.........250.........260.........270.........280
Sequence GIGCHVDACLGGFILPWAERLGYPVPPFDFRLEGVTSVSADTHYGYGAKGTSVILYRRPDLLHYQYFIAA
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) T

TTTTTTTT





STTSTT









SS
SSTTT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence DWPGGLYFSPTFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S
TT
SSSS
SS

TSTT
SS

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence AVASDELNIYQVMEEMAGRGWRLNGLHRPPAFHVALTLRHTEPGVVDRFLADLQDAVAQVRAHPEKATGM
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
SSS
TTT
B
TTTT

GGGGSTT
TT


TT
 .........430.........440.........450
Sequence APVYGMAAAAPPELVRQVLTGFIDLLYEVH
Predicted secondary structure




SS confidence





























Known secondary structure (DSSP) S
T



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D