Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3madA_

Fold library idPDB HeaderMoleculeTitle
c3madA_PDB header: lyaseChain: A: PDB Molecule: sphingosine-1-phosphate lyase;PDBTitle: crystal structure of stspl (symmetric form)


Added to library: Wed Jan 9 16:23:59 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KPYRDRFPSHARLPRAGLPRAEILAEIAAMGAAESPAWRDGYASGAVYHGDEHHIAFLNEVYALQSQSNP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTTTTS


SS

SS


TT
BSSS
S


TT

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence LHPDLWPSTAKFEAEVVAMTAHMLGGDAAGGTVCGTVTSGGTESLLLAMKTYRDWARATKGITAPEAVVP
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T
TTT
TTGGGGTS

SS

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence VSAHAAFDKAAQYFGIKLVRTPLDADYRADVAAMREAITPNTVVVAGSAPGYPHGVVDPIPEIAALAAEH
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTS
TT

B
TTS
B


TTTT
TTT




 .........220.........230.........240.........250.........260.........270.........280
Sequence GIGCHVDACLGGFILPWAERLGYPVPPFDFRLEGVTSVSADTHYGYGAKGTSVILYRRPDLLHYQYFIAA
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) T

TTTTTTTT





STTSTT









SS
SSTTT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence DWPGGLYFSPTFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S
TT
SSSS
SS

TSTT
SS

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence AVASDELNIYQVMEEMAGRGWRLNGLHRPPAFHVALTLRHTEPGVVDRFLADLQDAVAQVRAHPEKATGM
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
SSS
TTT
B
TTTT

GGGGSTT
TT


TT
 .........430.........440.........450
Sequence APVYGMAAAAPPELVRQVLTGFIDLLYEVH
Predicted secondary structure




SS confidence





























Known secondary structure (DSSP) S
T



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D