Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3m8lA_

Fold library idPDB HeaderMoleculeTitle
c3m8lA_PDB header: virusChain: A: PDB Molecule: capsid protein;PDBTitle: crystal structure analysis of the feline calicivirus capsid protein


Added to library: Sat Aug 28 18:07:40 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SITTPEQGTTVGGVIAEPSVQMSAAADMATGKSVDSEWEAFFSFHTSVNWSTSETQGKILFKQSLGPLLN
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)



SS
S




TT



SSSSSTT
TTT


SS
SSTTS



S
S
TT




STTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence PYLTHLAKLYVAWSGSIEVRFSISGSGVFGGKLAAIVVPPGIEPIQSTSMLQYPHVLFDARQVEPVIFTI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTBS
S


TT
B




TT



SSGGGG
SS

TT

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence PDLRSTLYHLMSDTDTTSLVIMIYNDLINPYANDSNSSGCIVTVETKPGPDFKFHLLKPPGSMLTHGSVP
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)



SSS
B
S

S




SS

B
S

SSSS


TT

SB

TT


TT


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence CDLIPKSSSLWIGNRFWSDITDFVIRPFVFQANRHFDFNQETAGWSTPRFRPITVTISQKEGEMLGIGVA
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TT
S
SSSTT


SS
SS

SB



TT


TT



SSS
SS


B



B

SSSS
B



 .........290.........300.........310.........320.........330.........340.........350
Sequence TDYIVPGIPDGWPDTTIPNELIPAGDYAITNQSGNDIQTKEEYESAMIISNNTNFKSMYICGSLQRAWGN
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP) TT
SSSS

TT

S


SS


S


S
SSSS



S




SS
SSS

S

SS
S






SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence KKVSNTAFITTATVKENKLIPSNTIDQTKIAIFQDNHVNRDVQTSDDTLALLGYTGIGEEAIGADREKVV
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)







SS

BTTB



SB

STT








SS







B





S

BS
STTTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence RIGVLPEAGARGGNHPIFYRNSMKLGYVIKSIDVFNSQILHTSRQLSLNNYLLSPDSFAVYRIIDSNGSW
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) BSS




B
BTTB


SSSSS

SS
TTS




TTB


SSS
 .........500.........510.........520.........530....
Sequence FDIGIDSDGFSFVGVSSIGKLEFPLTASYMGNQLAKIRLASNIR
Predicted secondary structure













SS confidence











































Known secondary structure (DSSP)

TTS



S





S







BSSS





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D