Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3m18A_

Fold library idPDB HeaderMoleculeTitle
c3m18A_PDB header: immune systemChain: A: PDB Molecule: variable lymphocyte receptor a diversity region;PDBTitle: crystal structure of variable lymphocyte receptor vlra.r2.1 in complex2 with hen egg lysozyme


Added to library: Sat Aug 28 20:49:19 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TCETVTGCTCNEGKKEVDCQGKSLDSVPSGIPADTEKLDLQSTGLATLSDATFRGLTKLTWLNLDYNQLQ
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)

SSSTT
TTTT
TT


SS

TT

TT


TTS





TTTTTT
TT


TTS


 .........80.........90.........100.........110.........120.........130.........140
Sequence TLSAGVFDDLTELGTLGLANNQLASLPLGVFDHLTQLDKLYLGGNQLKSLPSGVFDRLTKLKELRLNTNQ
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)


TTTTTT
TT


TTS





TTTTTT
TT



SS





TTTTTT
TT



SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LQSIPAGAFDKLTNLQTLSLSTNQLQSVPHGAFDRLGKLQTITLFGNQFDCSRCETLYLSQWIRENSNKV
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)




TTTTTT
TT



SS

S


TTTTTT
TT



SS
B
TTSTTTGGGB
 .........220.........230.........240.....
Sequence KDGTGQNLHESPDGVTCSDGKVVRTVTNETLKYEC
Predicted secondary structure

























SS confidence


































Known secondary structure (DSSP)
SSSSTT



GGG
BBTTS
BGGG

TTTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D