Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3lvrE_

Fold library idPDB HeaderMoleculeTitle
c3lvrE_PDB header: protein transportChain: E: PDB Molecule: arf-gap with sh3 domain, ank repeat and ph domain-PDBTitle: the crystal structure of asap3 in complex with arf6 in transition2 state soaked with calcium


Added to library: Sun Aug 29 06:54:59 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

STSTTTTB
TTT

BS

TTTT

TTT

TTTS


GGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence LALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTEPQRLWTAICNRDLLSV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

TTT

STT
S


TT

TT
TTS




T
 .........150.........160.........170.........180.........190.........200.........210
Sequence LEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKADGNTALHYAALYNQ
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TT

TTS

SSS

S
T

TTTT

TT






TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence PDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQANKEMRILMLGLDAAGKTTILYKLKL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T



S


TT


TT
TTT




STTSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence GQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHR
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SS






SS
SS



GGGSTTGGGGTTT

SS

TT
 .........360.........370.........380.........390.........400.........410.........
Sequence IINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Predicted secondary structure



























SS confidence




































































Known secondary structure (DSSP) TSTT
TT

TTSSS


TT
TT

SS
BTTTTBT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D