Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3lvgE_

Fold library idPDB HeaderMoleculeTitle
c3lvgE_PDB header: structural proteinChain: E: PDB Molecule: clathrin light chain b;PDBTitle: crystal structure of a clathrin heavy chain and clathrin light chain2 complex


Added to library: Wed Jan 9 23:11:43 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XXXXXXXXXXXXXXIAQADRLTQEPESIRKWREEQRKRLQELDAASKVMEQEWREKAKKDLEEWNQRQSE
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TTGGGT

TTTT






TTTTTTSSSST
 .........80.........90.........100.........110......
Sequence QVEKNKINNRIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure


SS confidence













































Known secondary structure (DSSP) TT



TT

STTTTSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D