Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3lvgD_

Fold library idPDB HeaderMoleculeTitle
c3lvgD_PDB header: structural proteinChain: D: PDB Molecule: clathrin light chain b;PDBTitle: crystal structure of a clathrin heavy chain and clathrin light chain2 complex


Added to library: Wed Jan 9 14:36:45 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAD
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)

TTTTSS


TTTTTSSSS


TTTTTSSSS


TT












S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RLTQEPESIRKWREEQRKRLQELDAASKVMEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQ
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TTTTSTTTTTSTTT
SSTTTSS
 .........150.........160.........170.........180
Sequence PDADIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure
















SS confidence







































Known secondary structure (DSSP)

TTT


TTT
S
TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D