Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3ljnA_

Fold library idPDB HeaderMoleculeTitle
c3ljnA_PDB header: unknown functionChain: A: PDB Molecule: hypothetical protein;PDBTitle: ankyrin repeat protein from leishmania major


Added to library: Sat Aug 28 23:30:08 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SDDENXEKIHVAARKGQTDEVRRLIETGVSPTIQNRFGCTALHLACKFGCVDTAKYLASVGEVHSLWHGQ
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

T
TT

TT


TT










BTTB
 .........80.........90.........100.........110.........120.........130.........140
Sequence KPIHLAVXANKTDLVVALVEGAKERGQXPESLLNECDEREVNEIGSHVKHCKGQTALHWCVGLGPEYLEX
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
TT
T

T





TTS


S
GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence IKILVQLGASPTAKDKADETPLXRAXEFRNREALDLXXDTVPSKSSLRLDYANKQGNSHLHWAILINWED
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) T

TT


TTS

TT

S
SSS

TT


TT


TTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence VAXRFVEXGIDVNXEDNEHTVPLYLSVRAAXVLLTKELLQKTDVFLIQACPYHNGTTVLPDRVVWLDFVP
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TTT

TT


TTS

T

S
T
TTBSSSSB
GGG



TTS
 .........290.........300....
Sequence AAADPSKQEVLQLLQEKLDEVVRS
Predicted secondary structure










SS confidence























Known secondary structure (DSSP) SS

T


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D