Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3kk7B_

Fold library idPDB HeaderMoleculeTitle
c3kk7B_PDB header: cell invasionChain: B: PDB Molecule: putative cell invasion protein with mac/perforinPDBTitle: crystal structure of putative cell invasion protein with2 mac/perforin domain (np_812351.1) from bacteriodes3 thetaiotaomicron vpi-5482 at 2.46 a resolution


Added to library: Sat Aug 28 20:16:17 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TSEIILQERNSSLPRVWSKKTFTDATDFLGCSYAVENGTSIIGDFANAKYPVVNXKKLLERYPSYINPKE
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)





TTS









SGGGGTT
STTS


TT
GGGSB

GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence LRTTETKALSYSDFDRLEKNKTFTKTVKSGFSLNLGPFKFGRQKTIKETFVHNTDDSEKVVHGELSIEVV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SSTTGGGTT
TTGGGB
TTS


SS





TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence NGXLNLQTAPSALRKIAADYLDELFVDALYNSSXVELXQSYGEFVLTGYYTGGRASALFYGVDTNSIQFD
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)



B
S

S
SS

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence SKEKDXDVAINASYEWKGNLSIGTKRENSETITNKFSALSYSIKTLGGAYGYSISTPPYDITNYSIDLTP
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TS


S

TTTTTTSSSSS

S



TTT


 .........290.........300.........310.........320.........330.........340.........350
Sequence WLQSLNDPKTHTXIDLQDGGLYPISDFILEENFKQRYNDTHXDFQYQESLEEPYIEIIKXYIRKSNSGEK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTSGGG

TT
GGGG


TTS



S




TTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LYDIVPVLNTRQGDKLIFSNPDAASQSDEELKANSIPATFLTKSNAIKDEKSKYYQLKIKADPNKTINPI
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TTS

GGGGGS
TTSTTT

SSS
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence IQTTLSFQINNVDEKGXYKFKNANTNIWYIYNPTSXYCFAYYDDDYIPDAYGILDWVNGIPIKAVTXTTL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

S
T

GGG
TTTTTTTTS
TT
S
B



 .........
Sequence YQRYKIYGL
Predicted secondary structure

SS confidence








Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D