Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3khdA_

Fold library idPDB HeaderMoleculeTitle
c3khdA_PDB header: transferaseChain: A: PDB Molecule: pyruvate kinase;PDBTitle: crystal structure of pff1300w.


Added to library: Wed Jan 9 14:36:52 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AAGASMQSAANITLRQILEPNVNLRSKKTHIVCTLGPACKSVETLVKLIDAGMDICRFNFSHGSHEDHKE
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

S

T

S




GGG
SS

GGG
STTTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence MFNNVLKAQELRPNCLLGMLLDTKGPEIRTGFLKLKLVTDYEFLGDETCIACSYKKLPQSVKPNIILIAD
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SS







B


S
TT

TTBS
TT



TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GSVSCKVLETHEDHVITEVLNAVIGERKNMNLPNVKVDLPIISEKDKNDILNFAIPMGCNFIAASFIQSA
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT
SS






SS

TTS


S
SS
TT

TT

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DDVRLIRNLLGPRGRHIKIIPKIENIEGIIHFDKILAESDGIMIARGDLGMEISPEKVFLAQKLMISKCN
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTTTTS
STSS

TTTS
GGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence LQGKPIITATQMLESMTKNPRPTRAEVTDVANAVLDGTDCVMLSGETAGGKFPVEAVTIMSKICLEAEAC
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T






GGGGT
SS

T
SSS
S
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence IDYKLLYQSLVNAIETPISVQEAVARSAVETAESIQASLIIALTETGYTARLIAKYKPSCTILALSASDS
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

S
S


TT
S
SSST

SSS
 .........430.........440.........450.........460.........470.........480.......
Sequence TVKCLNVHRGVTCIKVGSFQGTDIVIRNAIEIAKQRNMAKVGDSVIAIHGKEEVSGGTNLMKVVQIE
Predicted secondary structure

























SS confidence


































































Known secondary structure (DSSP) GGGSTT

S


TTSS
TT



SSTT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D