Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3khdA_

Fold library idPDB HeaderMoleculeTitle
c3khdA_PDB header: transferaseChain: A: PDB Molecule: pyruvate kinase;PDBTitle: crystal structure of pff1300w.


Added to library: Wed Jan 9 14:36:52 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AAGASMQSAANITLRQILEPNVNLRSKKTHIVCTLGPACKSVETLVKLIDAGMDICRFNFSHGSHEDHKE
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

S

T

S




GGG
SS

GGG
STTTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence MFNNVLKAQELRPNCLLGMLLDTKGPEIRTGFLKLKLVTDYEFLGDETCIACSYKKLPQSVKPNIILIAD
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SS







B


S
TT

TTBS
TT



TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GSVSCKVLETHEDHVITEVLNAVIGERKNMNLPNVKVDLPIISEKDKNDILNFAIPMGCNFIAASFIQSA
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT
SS






SS

TTS


S
SS
TT

TT

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DDVRLIRNLLGPRGRHIKIIPKIENIEGIIHFDKILAESDGIMIARGDLGMEISPEKVFLAQKLMISKCN
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTTTTS
STSS

TTTS
GGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence LQGKPIITATQMLESMTKNPRPTRAEVTDVANAVLDGTDCVMLSGETAGGKFPVEAVTIMSKICLEAEAC
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T






GGGGT
SS

T
SSS
S
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence IDYKLLYQSLVNAIETPISVQEAVARSAVETAESIQASLIIALTETGYTARLIAKYKPSCTILALSASDS
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

S
S


TT
S
SSST

SSS
 .........430.........440.........450.........460.........470.........480.......
Sequence TVKCLNVHRGVTCIKVGSFQGTDIVIRNAIEIAKQRNMAKVGDSVIAIHGKEEVSGGTNLMKVVQIE
Predicted secondary structure

























SS confidence


































































Known secondary structure (DSSP) GGGSTT

S


TTSS
TT



SSTT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D