Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3keaB_

Fold library idPDB HeaderMoleculeTitle
c3keaB_PDB header: viral proteinChain: B: PDB Molecule: k1l;PDBTitle: structure function studies of vaccinia virus host-range2 protein k1 reveal a novel ankyrin repeat interaction3 surface for k1s function


Added to library: Sat Aug 28 18:14:22 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GXDLSRINTWKSKQLKSFLSSKDTFKADVHGHSASYYAIADNNVRLVCTLLNAGALKNLLENEFPLHQAA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)



TTGGG

STTTT


TTS

TT
TTGGGS

TT

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence TLEDTKIVKILLFSGLDDSQFDDKGNTALYYAVDSGNXQTVKLFVKKNWRLXFYGKTGWKTSFYHAVXLN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TSSS
TT

TT


TTS

T

GGGGG
SSSGGGSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DVSIVSYFLSEIPSTFDLAILLSCIHITIKNGHVDXXILLLDYXTSTNTNNSLLFIPDIKLAIDNKDIEX
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTS
TT


STTT
T
TT


B

TTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LQALFKYDINIYSANLENVLLDDAEIAKXIIEKHVEYKSDSYTKDLDIVKNNKLDEIISKNKELRLXYVN
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTS
B
STTTT
GGGTTT

TTTTT
T
S
 ...
Sequence CVK
Predicted secondary structure

SS confidence


Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D