Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3kdpD_

Fold library idPDB HeaderMoleculeTitle
c3kdpD_PDB header: hydrolaseChain: D: PDB Molecule: sodium/potassium-transporting atpase subunitPDBTitle: crystal structure of the sodium-potassium pump


Added to library: Sat Aug 28 16:45:17 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)




SSS
SS
S

GGGS
S
SSS
S

TTT
S



BSS

SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence ISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRSRLEWLG
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

SS
TTTTTT

TTTS
STTT


SS








SSSSSSS




GGGST
 .........150.........160.........170.........180.........190.........200.........210
Sequence NCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTM
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) TS



SSS



SSS

B
B




BT






SSS
SS
SSS

TTTB

SSSSS






B
 .........220.........230.........240.........250.........260.........270.........280
Sequence EYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDV
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)



TTS
SS
BTTS
SB
TTTS
TT






B
B

S

S



B
STT



SS
TTTTS

B
 ......
Sequence KIEVKS
Predicted secondary structure

SS confidence





Known secondary structure (DSSP)



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D