Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3k2qA_

Fold library idPDB HeaderMoleculeTitle
c3k2qA_PDB header: transferaseChain: A: PDB Molecule: pyrophosphate-dependent phosphofructokinase;PDBTitle: crystal structure of pyrophosphate-dependent2 phosphofructokinase from marinobacter aquaeolei, northeast3 structural genomics consortium target mqr88


Added to library: Sat Aug 28 23:11:20 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IKNAFYAQSGGVTAVINASACGVIQTARKHPDQIGKVYAGRNGIIGALKEELIDTSLESDDAIQALIHTP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


SS

SSTT
TTT


TTTTT
GGGS
GGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence GGAFGSCRYKREYERLIEVFRAHDIGYFFYNGGGDSQDTAYKVSQLADRMGYPITCIGVPKTVDNDLPFT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S
TT






TTSTT



BTT


SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DCCPGFGSVAKYIATSTLEASLDIKSMCETSTKVFILEVMGRHAGWIAAAGGLAGQSEGEPPHVILFPEI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SS
TBTTTS



SS

GGGG

SSSSS
S
TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PFNREKFLERVDQCVRDYGYCVVVASEGAQYERFGVAPALANMVKQALGHKYHWAVADYLQRAARHIASA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)


TTTS
TT











GGGTTT
GGG
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence TDVEQAYAVGKAAVEMALAGKQALMPTIVRDQAKPYRWSIGEANLSEVANQEKKMPIHYITDNGFGITQD
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT

STTTTTT





GGGB
TTSSSB
 .........360.........370.........380.........390..
Sequence CRDYLQPLIAGESFPPFDDGLPRVAKLKNQLVEKKLRTEFEL
Predicted secondary structure


























SS confidence









































Known secondary structure (DSSP) GGGG
SB



TT







B



S






Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D