Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3jxiA_

Fold library idPDB HeaderMoleculeTitle
c3jxiA_PDB header: membrane proteinChain: A: PDB Molecule: vanilloid receptor-related osmotically activatedPDBTitle: crystal structure of the chicken trpv4 ankyrin repeat domain


Added to library: Sat Aug 28 18:02:26 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKVFNRPILFDIVSRGSPDGLEGLLSFLLTHKKRLTDEEFREPSTGKTCLPKALLNLSAGRNDTIPILLD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)




T
GGGGTTT

TTSGGGS
TTT


TS
BTTB
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence IAEKTGNMREFINSPFRDVYYRGQTALHIAIERRCKHYVELLVEKGADVHAQARGRFFQPKDEGGYFYFG
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT
T

B

SSSB
TT
TT

TT





SSS



S

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence ELPLSLAACTNQPHIVHYLTENGHKQADLRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLIKCAK
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SSTT

SS



TT


TTS



SS
 .........220.........230.........240.........250...
Sequence LFPDTNLEALLNNDGLSPLMMAAKTGKIGIFQHIIRREIADAA
Predicted secondary structure

















SS confidence










































Known secondary structure (DSSP)
TT

GGG


TTS

TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D